PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400035595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 381aa    MW: 42515.9 Da    PI: 7.7213
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400035595genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA503.9e-16741135
                  GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                          C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  PGSC0003DMP400035595  7 CYHCGVTSTPLWRNGPPEKPILCNACGSRWRTKGT 41
                          ****************66666***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.8E-9155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.9E-11445No hitNo description
CDDcd002021.14E-16655No hitNo description
PfamPF003206.3E-14741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF139192.5E-7283336IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MGKEGPCYHC GVTSTPLWRN GPPEKPILCN ACGSRWRTKG TLVNYTPLHA RAEPCDFEEH  60
RVSRFKNISM KNKEAKILKR KQSHDNAEVG TPPDYNLGFR KVLDEDTSNR SSSGSAVSNS  120
ESCAQFGSAE ASDLTGPAQS NIWDSTVPSR KRTCFNRPKP SSVEKLTKDL YTILHEQQSS  180
YLSASSEEEL LFESDKPMVS VEIGHGSVLM RHPSTIGREE ESEASSLSVD NKHRSVSDAY  240
SRLTTPPVNI SKGVNSPNMG TERIKKPTGP AIEQDQIKRN KDHLEKLQIL GHHNSPLRYI  300
DLKDVLNYEE FTSHLSSDEQ QQLLKYLPPV DSFAPPDRFV CLLCCSLSRS CFGFILNSNK  360
KENLIQVAHQ LIVFVFFSLS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362478.10.0PREDICTED: GATA transcription factor 26-like
SwissprotQ8W4H11e-116GAT26_ARATH; GATA transcription factor 26
TrEMBLM1BTZ30.0M1BTZ3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000528000.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-108GATA transcription factor 26
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]